PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g065800.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TCP
Protein Properties Length: 143aa    MW: 16204.5 Da    PI: 9.6825
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g065800.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.41.3e-3043111270
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                          g+kdrhsk+ T +g+RdRRvRls+++a +++dLqd+LG+d++sk ++WLl++ak+ i+el+ ++  ++
  Solyc02g065800.1.1  43 FGGKDRHSKVLTVKGLRDRRVRLSVPTALQVYDLQDKLGLDQPSKVVDWLLNEAKHDIDELPPLQIRDQ 111
                         689***********************************************************9955444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.9945103IPR017887Transcription factor TCP subgroup
PfamPF036342.4E-2945130IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MISREVDPSD NNVIMIPKKS SLSSSSSWTR FKDPRIVRVS RAFGGKDRHS KVLTVKGLRD  60
RRVRLSVPTA LQVYDLQDKL GLDQPSKVVD WLLNEAKHDI DELPPLQIRD QTGLPLTGLR  120
KEEEETMVVS DEDRVKLDVR NT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2468130.0Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-33h20 map 2, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065471.13e-87PREDICTED: transcription factor TCP13-like
SwissprotQ9S7W51e-41TCP13_ARATH; Transcription factor TCP13
TrEMBLK4B7116e-98K4B711_SOLLC; Uncharacterized protein
STRINGSolyc02g065800.1.12e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.17e-43plastid transcription factor 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]